PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4647s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 1656aa    MW: 181437 Da    PI: 6.9241
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4647s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.61.1e-11872913346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +WT eE e+++++ +++G++ +k+Ia+++   +t  +c+++++k
  Araha.4647s0008.1.p 872 PWTSEEKEIFLNLLALHGKD-FKKIASYLT-QKTTADCIDYYYK 913
                          8*****************99.********9.9**********98 PP

2Myb_DNA-binding28.92.6e-0910871128447
                           S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                           WT +E   +++++ ++G++ +++I+r++g +R++ qck ++ k+
  Araha.4647s0008.1.p 1087 WTDDERSAFIQGFSLFGKN-FASISRYVG-TRSPDQCKVFFSKV 1128
                           *****************99.*********.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-14855916IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-7864915IPR009057Homeodomain-like
PROSITE profilePS5129314.571868919IPR017884SANT domain
SMARTSM007174.5E-10869917IPR001005SANT/Myb domain
PfamPF002491.2E-9871913IPR001005SANT/Myb domain
CDDcd001672.10E-8872914No hitNo description
PROSITE profilePS5129313.03910821133IPR017884SANT domain
SMARTSM007174.0E-810831131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-510861127IPR009057Homeodomain-like
SuperFamilySSF466891.01E-910861133IPR009057Homeodomain-like
CDDcd001675.06E-710871128No hitNo description
PfamPF002491.4E-710871127IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1656 aa     Download sequence    Send to blast
MPQDHASWDR KELLRQRKHD RPEQSFDSPP FRWRDSPSTP SSHHVPREFS SRWGSADFRR  60
PSCHGKQGGR HQFVEETSHG YASSRSSARM FDNDYYRPSA SRGDWRYTRN CRDDRVSVSQ  120
KEWKCNTWEM SNGSSRSFER PFGIRNGRRS VDERPLHASD THTTVVNSLD PANSTHQPDN  180
EICTPVRSLK FKNEQKFSDQ RLSLPSDPHS DCVSLFEQPP SENNYGNKVC SPAKQCNDLM  240
YGRRLANDNS LDPPILNVEL EGTWEQLHLK DPQDNNRLHG ISDLDGASKC AKESSLGATG  300
KLPLWNSSGS FASQSSGFSH SSSLKSLGAV DSSDRKIEVL PKIVTVTQSS SGDATACATT  360
THLSEEMSSR KKQRLGWGEG LAKYEKKKVD VNTNEDGTTL LENSSEELHS LNKNIADKSP  420
TAAIVPDYGS PTTPSSVACS SSPGFADKSS PKAAIAASDV SNMYRSPSPV SSIHLERFPI  480
NIEELDNISM ERFGCLLNEL LGTDDPGTGD SSSAQLTSMN RLLAWKGEIL KAVEMTESEI  540
DLLENKHRTL KLEGGRHCRV VQPSSYLCEG DANVPKEQAS CILDPKAAAS SVAETLVRST  600
VHQAALAKVP VDVSEDNPGA VKSLSQSFAT VKSNEDILPI PSMKAAASSK DHNTPAFANQ  660
ETIEVSSADD SMASNEDLLC AKLLSANKKY ACESSGVFDE LLPKDFSSSD NSRFPGICQT  720
QFDSHVKEKI ADRVDLLRAR EKILLLQFKA FQLSWKKDLD QLALTKYQSK SSKKTELYPN  780
AKNGGYLKLP QPVRLRFSSS APRRDSVVPT TELVSYMEKL LPGTHLKPFR DILKMPAMIL  840
DEKERVMSRF ISSNGLIEDP CDVEKERTMI NPWTSEEKEI FLNLLALHGK DFKKIASYLT  900
QKTTADCIDY YYKNHKSDCF GKIKKQRAYG KEGKHTYMLA PRKKWKREMG AASLDILGDV  960
SIIAANAGKV ASTRLISSKK ITLRGCSSAN SLQNDGNNSE GCSYSFDFPR KRTAGADVLA  1020
VGPLSSEQIN SCLRTSVSSR ERCMDHLKFN HVVKKPRISH TLHNENSNEE DDSCSEESCG  1080
ETGPIHWTDD ERSAFIQGFS LFGKNFASIS RYVGTRSPDQ CKVFFSKVRK CLGLEFIQSG  1140
SGNVSTSVSV DNGNEGGGSD LEDPCPMESN SGICDNGVCA KMGMNSPTSP FNMNRDGANY  1200
SGSANGKADL SRSEQENGQT YLCVKDDNNL VNNAYINGGF PSLVSETCRD LVDINTVESQ  1260
SQAAGKSKSN DLMSMEIDEG VLTSVAVSSE PLYCGLSVLS NVIVETPTEI SRKGSGDQGA  1320
AIPKLSSKNQ DEVMQAANRT RNSGLEPESA PSGFRYPECL HHVPIEVCTE NPIGVSVPRG  1380
NPNCHAESES GNSLVGKVVE THDLGWQSSK NNLELDGRLR VLGHVNPEQN GQLNATNAGS  1440
CQIPQRVVTQ DLSRISRSKS DLIVKTQRTG EGFTLNKCTS SAPKPLAVFH KEGRSGHSRS  1500
HSFSLSDTER LDKNGDVKLF GTVLTADENG IKQKHNPCGI VRSSSALSRD HDTRHHYINQ  1560
QHLQNVPITS YGFWDGNRIQ TGLTSLPESA KLLASCPEAF STHLKQQVGN SKEILLDVHG  1620
GVLSFGKHNE DRAESSSAKD EGNIGGVNGV AEAAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-15830920493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-15830920493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF5469830.0HF546983.1 Arabis alpina myb gene for myb like transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002876132.10.0myb family transcription factor
TrEMBLD7LU400.0D7LU40_ARALL; Myb family transcription factor
STRINGscaffold_502292.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein